2r is the irregular law firm dealing with cases against organized crime, religious crimes, large-scale fraud, corruption.  Founded in 2001 by Raevskaya-Repnina. www.irregulaw.com #2R #lawfirm #irregulaw #beinghuman #raevskayarepnina #organisedcrime #corruption #naturallaw #humanrights #criminaljustice #criminology #humanrights #equality #diversity #startedinoxford #oxfordsbs #oxfordbusinessalumni #saidbusinessschool #universityofoxford #russia #global #moscow #uk #oxford #portsmouth #london  #womanfounders #serialentrepreneur #womeninlaw #womeninbusiness #раевскаярепнина #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #raevskayarepnina #annamariaserafimaraevskayarepnina #raevskayarepninaannamariaserafima

#IRREGULAW

 
2r is the irregular law firm dealing with cases against organized crime, religious crimes, large-scale fraud, corruption. www.irregulaw.com #2R #lawfirm #irregulaw #beinghuman #raevskayarepnina #organisedcrime #corruption #naturallaw #humanrights #criminaljustice #criminology #humanrights #equality #diversity #startedinoxford #oxfordsbs #oxfordbusinessalumni#раевскаярепнина #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #raevskayarepnina #annamariaserafimaraevskayarepnina #raevskayarepninaannamariaserafima

2r is the irregular law firm dealing with cases against organized crime, religious crimes, large-scale fraud, corruption. 

 

Irregular Law

 

2r works with law anomalies - when regular law does not work as it should be due to organized crime, corruption, politics, or something else. 2r focuses on irregular, enormous projects, combining law, finance, business, economics, religious, political issues. Irregularity implies that 2r works on an irregular basis. We arrange for the team to address the specific needs of an individual project. 

 

2r offers the complete set of services for

non-standard situations.

 
2r is the irregular law firm dealing with cases against organized crime, religious crimes, large-scale fraud, corruption.  Founded in 2001 by Raevskaya-Repnina. www.irregulaw.com #2R #lawfirm #irregulaw #beinghuman #raevskayarepnina #organisedcrime #corruption #naturallaw #humanrights #criminaljustice #criminology #humanrights #equality #diversity #startedinoxford #oxfordsbs #oxfordbusinessalumni #saidbusinessschool #universityofoxford #russia #global #moscow #uk #oxford #portsmouth #london  #womanfounders #serialentrepreneur #womeninlaw #womeninbusiness #раевскаярепнина #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #raevskayarepnina #annamariaserafimaraevskayarepnina #raevskayarepninaannamariaserafima

Our Services

2R works with the businesses or shareholders facing a hostile takeover, any forms of illegal prosecution, an unlawful conviction of a felony, unlawful tax claims.

2R helps when the case combines economics, business, political, religious, security, tax evasion, corruption issues if you are a victim. 

2R mitigates corporate conflicts and protects your company from illegal capture.

2R investigates corporate fraud as well as difficult sensitive or confidential issues.

 

Our Competencies

Criminal Law

Civil Law

Religious crimes cases

Tax Law

International Law

M&A

Corporate disputes

Corporate fraud

Investigations​

2r is the irregular law firm dealing with cases against organized crime, religious crimes, large-scale fraud, corruption.  Founded in 2001 by Raevskaya-Repnina. www.irregulaw.com #2R #lawfirm #irregulaw #beinghuman #raevskayarepnina #organisedcrime #corruption #naturallaw #humanrights #criminaljustice #criminology #humanrights #equality #diversity #startedinoxford #oxfordsbs #oxfordbusinessalumni #saidbusinessschool #universityofoxford #russia #global #moscow #uk #oxford #portsmouth #london  #womanfounders #serialentrepreneur #womeninlaw #womeninbusiness #раевскаярепнина #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #raevskayarepnina #annamariaserafimaraevskayarepnina #raevskayarepninaannamariaserafima

The Distinction of the 2R

Multi-dimensional Approach

2R analyzes every case and develops a strategy of the litigation based on a 360-degree methodology. 2R considers all aspects of the case beyond the legal issues.

 

Standardization of Response 

 During the years of practice, 2R has developed the standard approach for every irregulaw case. We apply that for every non-standard situation, which is routine for us.  Our strategy is based on the predefined set of actions that we perform in the predefined sequence.

Civil Claim in Criminal Process

If the loss has been caused by the criminal offense, the real loss indemnification will be possible just as a civil claim in the criminal process. You never win if the civil process starts first. Our strategy is to reach the starting of a criminal proceeding, collect evidence, and avoid the civil claims as long as possible, even though it can be very hard.

 
2r is the irregular law firm dealing with cases against organized crime, religious crimes, large-scale fraud, corruption.  Founded in 2001 by Raevskaya-Repnina. www.irregulaw.com #2R #lawfirm #irregulaw #beinghuman #raevskayarepnina #organisedcrime #corruption #naturallaw #humanrights #criminaljustice #criminology #humanrights #equality #diversity #startedinoxford #oxfordsbs #oxfordbusinessalumni #saidbusinessschool #universityofoxford #russia #global #moscow #uk #oxford #portsmouth #london  #womanfounders #serialentrepreneur #womeninlaw #womeninbusiness #раевскаярепнина #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #raevskayarepnina #annamariaserafimaraevskayarepnina #raevskayarepninaannamariaserafima

Cases

Hostile takeovers

Bank of Moscow

Investlesprom

Eldorado

Sunrise

Bananamama

BOOST

Teploservice

Priladozhie

 

Unlawful tax claims

Eldorado

BOOST

Priladozhie

 

 

 

2r is the irregular law firm dealing with cases against organized crime, religious crimes, large-scale fraud, corruption.  Founded in 2001 by Raevskaya-Repnina. www.irregulaw.com #2R #lawfirm #irregulaw #beinghuman #raevskayarepnina #organisedcrime #corruption #naturallaw #humanrights #criminaljustice #criminology #humanrights #equality #diversity #startedinoxford #oxfordsbs #oxfordbusinessalumni #saidbusinessschool #universityofoxford #russia #global #moscow #uk #oxford #portsmouth #london  #womanfounders #serialentrepreneur #womeninlaw #womeninbusiness #раевскаярепнина #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #raevskayarepnina #annamariaserafimaraevskayarepnina #raevskayarepninaannamariaserafima

Defendants

100% of cases supported by 2R are dealing against organized crime, including public administration, and criminalized financial groups. 

 

Learn more about us

2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW
2R Law Firm. #IRREGULAW

Statistics

Founded in 2001 by Raevskaya-Repnina

18 years of practice

400+ legal cases

Total number of lost: 0

2r is the irregular law firm dealing with cases against organized crime, religious crimes, large-scale fraud, corruption.  Founded in 2001 by Raevskaya-Repnina. www.irregulaw.com #2R #lawfirm #irregulaw #beinghuman #raevskayarepnina #organisedcrime #corruption #naturallaw #humanrights #criminaljustice #criminology #humanrights #equality #diversity #startedinoxford #oxfordsbs #oxfordbusinessalumni #saidbusinessschool #universityofoxford #russia #global #moscow #uk #oxford #portsmouth #london  #womanfounders #serialentrepreneur #womeninlaw #womeninbusiness #раевскаярепнина #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #raevskayarepnina #annamariaserafimaraevskayarepnina #raevskayarepninaannamariaserafima

Get the quote

Send 
 
 
Contacts

Opening hours: 24/7

10, Vozdvizhenka,

Moscow, 125009

Russian Federation

Phone +7 495 748 81 78

Whatsapp +7 925 382 63 08

2r@irregulaw.com

www.irregulaw.com

  • 2r is the irregular law firm dealing against organized crime, large-scale fraud, corruption.  Founde
  • 2r is the irregular law firm dealing against organized crime, large-scale fraud, corruption.  Founde
  • 22r is the irregular law firm dealing against organized crime, large-scale fraud, corruption.  Found
  • 2r is the irregular law firm dealing against organized crime, large-scale fraud, corruption.  Founde
  • 2r is the irregular law firm dealing against organized crime, large-scale fraud, corruption.  Founde

#IRREGULAW

BEING HUMAN
2r is the irregular law firm dealing with cases against organized crime, religious crimes, large-scale fraud, corruption.  Founded in 2001 by Raevskaya-Repnina. www.irregulaw.com #2R #lawfirm #irregulaw #beinghuman #raevskayarepnina #organisedcrime #corruption #naturallaw #humanrights #criminaljustice #criminology #humanrights #equality #diversity #startedinoxford #oxfordsbs #oxfordbusinessalumni #saidbusinessschool #universityofoxford #russia #global #moscow #uk #oxford #portsmouth #london  #womanfounders #serialentrepreneur #womeninlaw #womeninbusiness #раевскаярепнина #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #raevskayarepnina #annamariaserafimaraevskayarepnina #raevskayarepninaannamariaserafima
This site was designed with the
.com
website builder. Create your website today.
Start Now