top of page
Rare Food is a startup working in Russia and the UK, combining seed and toxic assets. We produce and sell easily accessible sustainable healthy vegan food. Our business is to produce healthy vegan food, healthy vegan junk food, planted meat, and milk products that are integrated with its multi-format multi-branded retail. Our food production and retail business are supported by end-to-end integrated circular food plastic solutions. At the moment, we are developing in Russia and UK four projects: @HappyTurtle, @VisionCocktailHall, Ginnger, and @SantaFe. The ground base for all projects is planted food, healthy recipes, elimination of health-damaging components, smart packaging, and no alcohol. www.rarefood.ru www.boostcmg.com #rarefood #impossiblefood #plantedmeat #healthyjunkfood #veganonthego #happyturtle #visioncocktailhall #santafe #plantedmeat #plantedmilk #casualfood #dispensibleveganfood #hasheight #boost #raevskayarepninaannamariaserafima #аннамариясерафимараевскаярепнина #startedinoxford #oxfordbusinessalumni #oxfordsbs #moscow #london #russia #uk #raevskayarepninaannamariaserafimasergeevna #raevskayarepnina #annamariaserafimasergeevnaraevskayarepnina #раевскаярепнинааннамариясерафима #аннамариясерафимараевскаярепнина #раевскаярепнина #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #annamariaserafimaraevskayarepnina
Rare Food is a startup working in Russia and the UK. We produce and sell easily accessible sustainable healthy vegan food. www.rarefood.ru www.boostcmg.com #rarefood #impossiblefood #plantedmeat #healthyjunkfood #veganonthego #happyturtle #visioncocktailhall #santafe #plantedmeat #plantedmilk #casualfood #dispensibleveganfood #hasheight #boost #raevskayarepninaannamariaserafima #аннамариясерафимараевскаярепнина #startedinoxford #oxfordbusinessalumni #oxfordsbs #moscow #london #russia #uk #raevskayarepninaannamariaserafimasergeevna #raevskayarepnina #annamariaserafimasergeevnaraevskayarepnina #раевскаярепнинааннамариясерафима #аннамариясерафимараевскаярепнина #раевскаярепнина #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #annamariaserafimaraevskayarepnina
to About
Rare Food is a startup working in Russia and the UK. We produce and sell easily accessible sustainable healthy vegan food. www.rarefood.ru www.boostcmg.com #rarefood #impossiblefood #plantedmeat #healthyjunkfood #veganonthego #happyturtle #visioncocktailhall #santafe #plantedmeat #plantedmilk #casualfood #dispensibleveganfood #hasheight #boost #raevskayarepninaannamariaserafima #аннамариясерафимараевскаярепнина #startedinoxford #oxfordbusinessalumni #oxfordsbs #moscow #london #russia #uk #raevskayarepninaannamariaserafimasergeevna #raevskayarepnina #annamariaserafimasergeevnaraevskayarepnina #раевскаярепнинааннамариясерафима #аннамариясерафимараевскаярепнина #раевскаярепнина #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #annamariaserafimaraevskayarepnina

FEED YOUR SOUL

Rare Food is a startup working in Russia and the UK, combining seed and toxic assets integrated with its multi-format multi-branded retail to produce and sell healthy vegan food, planted meat, milk products, soft drinks, alternative alcohol-free spirits.

Image by Michael Kucharski

Thou shalt not kill.

PRODUCTION

Production

The business scope includes industrial horticulture, R&D, and production of vegan food & drinks only: planted meat, planted milk, milk products, planted substitutes of traditional protein - eggs, chicken, pork, fish, seafood, and others, semi-processed products, soft drinks, alternative spirits, raw food, ready-to-cook items.

TASTY

All our drinks and food have great taste and perfectly alleviate hunger. Rare Food tastes better than traditional animal-origin analogs and makes a positive impact on health and mood.

HEALTHY

We don't use ingredients calling food addictions, cancerogenesis additives, and other components provoking diseases. We use additives if they are necessary due to the technology that saves products until your consumption and has neutral or positive effects on health, e.g. citric acid.

FAIR PRICE

We are targeting all segments of mass-market by creating of product offer that is tastier, better, cheaper, and more accessible than widely distributed health-damaging expensive analogs. Prices for our products are lower than prices for the animal-origin peers. Our food has a lower price than harmful analogs because we don't spend money on health-damaging components and use fair trade ingredients. We are competing by the exceptional taste, quality, high product penetration, leading to high product accessibility and affordable low price.

SUSTAINABLE

Our products don't contain GMO ingredients, ingredients calling addictions. We minimize the usage of one-time packaging and create closed-loop packaging technology for our products. Rare Food is organic or produced according to technology providing the capability to minimize harmful pollutions and the consumption of chemicals.

ACCESSIBLE

We offer our products on the go through vending machines, in street retail, corners at food retail, and in canteens located at schools, business centers, public facilities. We make our products easily accessible for you 24/7. No need to drive to the vegan shop at the other end of the city, or try to find something vegan in the bulk product mix of standard retail.

Difference
Image by Ashes Sitoula

Thou shalt not kill.

Vegan on-the-go

The Rare Food aims to be a source of easily accessible healthy fast food selling predominantly on-the-go in public facilities, business centers, educational organizations, special shop-in-shop corners, street retail, and replacing household consumption of products of animal origin to eliminate that. Also, Rare Food strives to solve other traditional nutrition-related issues. They are: reduce food waste, create a closed-loop cycle in food packaging, minimize sales of packed products, provide a trustful source where people can buy healthy products for daily consumption at home at an affordable price, eliminate prejudice & discrimination against vegan products, promote customers awareness about how to make healthy daily consumer choice that also saves consumers money, decreases carbon impact & plastic waste. We know reality and will be happy if we can solve at least one problem.

Domestic Waste Bin

Thou shalt not kill.

Retail

Retail

At the moment, we are actively developing in Russia and the UK four multiformat food retail projects offering vegan food in different cuisines and a variety of non-alcohol drinks. 

VISION

24/7
DJ BAR/7

The Vision offers a great mix of music, impossible oriental vegan food, and the longest list of non-alcoholic drinks.

That's a graphic image from the Rare Food website. Read more on www.hasheight.com

VEGAN
SWEETS & CAKES

Ginnger is a manufacturer of vegan low calories sweets and cakes made of natural ingredients.

Rare Food is a startup working in Russia and the UK. We produce and sell easily accessible sustainable healthy vegan food. www.rarefood.ru www.boostcmg.com #rarefood #impossiblefood #plantedmeat #healthyjunkfood #veganonthego #happyturtle #visioncocktailhall #santafe #plantedmeat #plantedmilk #casualfood #dispensibleveganfood #hasheight #boost #raevskayarepninaannamariaserafima #аннамариясерафимараевскаярепнина #startedinoxford #oxfordbusinessalumni #oxfordsbs #moscow #london #russia #uk #raevskayarepninaannamariaserafimasergeevna #raevskayarepnina #annamariaserafimasergeevnaraevskayarepnina #раевскаярепнинааннамариясерафима #аннамариясерафимараевскаярепнина #раевскаярепнина #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #annamariaserafimaraevskayarepnina

VEGAN
ON-THE-GO

Healthy fast food for public facilities, business centers, educational organizations, integrated with the circular plastic solution.

Rare Food is a startup working in Russia and the UK. We produce and sell easily accessible sustainable healthy vegan food. www.rarefood.ru www.boostcmg.com #rarefood #impossiblefood #plantedmeat #healthyjunkfood #veganonthego #happyturtle #visioncocktailhall #santafe #plantedmeat #plantedmilk #casualfood #dispensibleveganfood #hasheight #boost #raevskayarepninaannamariaserafima #аннамариясерафимараевскаярепнина #startedinoxford #oxfordbusinessalumni #oxfordsbs #moscow #london #russia #uk #raevskayarepninaannamariaserafimasergeevna #raevskayarepnina #annamariaserafimasergeevnaraevskayarepnina #раевскаярепнинааннамариясерафима #аннамариясерафимараевскаярепнина #раевскаярепнина #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #annamariaserafimaraevskayarepnina

IMPOSSIBLE
TEX-MEX

Santa Fe is an impossible tex-mex end-to-end food project that includes its food production integrated with the multiformat food retail chain.

Image by Julia Joppien

Thou shalt not kill.

Contacts

Contacts

10, Vozdvizhenka, Moscow

Russian Federation

rarefood@hasheight.com

www.hasheight.com

Phone: +7 495 740 37 21

Whatsapp: +7 925 444 18 20

Thanks for submitting!

Image by Kenneth Schipper Vera

Thou shalt not kill.

Tell us!

Which vegan products do you love? Which products do you wish for shall be vegan?

SUBSCRIBE

Subscribe

30.png
Rare Food is a startup working in Russia and the UK. We produce and sell easily accessible sustainable healthy vegan food. www.rarefood.ru www.boostcmg.com #rarefood #impossiblefood #plantedmeat #healthyjunkfood #veganonthego #happyturtle #visioncocktailhall #santafe #plantedmeat #plantedmilk #casualfood #dispensibleveganfood #hasheight #boost #raevskayarepninaannamariaserafima #аннамариясерафимараевскаярепнина #startedinoxford #oxfordbusinessalumni #oxfordsbs #moscow #london #russia #uk #raevskayarepninaannamariaserafimasergeevna #raevskayarepnina #annamariaserafimasergeevnaraevskayarepnina #раевскаярепнинааннамариясерафима #аннамариясерафимараевскаярепнина #раевскаярепнина #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #annamariaserafimaraevskayarepnina
bottom of page