RARE APPAREL. Impossible fashion. Seed-stage startup in fashion, technology, and design. Vegan slow circular fashion. www.hasheight.com #hasheight #rareapparel #askmydress #hornofplenty #pokerface #annamariaserafimaraevskayarepnina #raevskayarepnina #аннамариясерафимараевскаярепнина  #raevskayarepninaannamariaserafima #annamariaserafimaraevskayarepnina #raevskayarepnina #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #раевскаярепнина  #oxfordbusinessalumni #startedinoxford #saidbusinessschool #oxfordsbs #oxford #moscow #london #russia #uk #womanfounders #serialentrepreneur #womeninlaw #womeninbusiness #theuniversityofoxford #innovateuk
16.png
RARE APPAREL. Impossible fashion. Seed-stage startup in fashion, technology, and design. Vegan slow circular fashion. www.hasheight.com #hasheight #rareapparel #askmydress #hornofplenty #pokerface #annamariaserafimaraevskayarepnina #raevskayarepnina #аннамариясерафимараевскаярепнина  #raevskayarepninaannamariaserafima #annamariaserafimaraevskayarepnina #raevskayarepnina #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #раевскаярепнина  #oxfordbusinessalumni #startedinoxford #saidbusinessschool #oxfordsbs #oxford #moscow #london #russia #uk #womanfounders #serialentrepreneur #womeninlaw #womeninbusiness #theuniversityofoxford #innovateuk

POKER FACE

APPAREL FOR NEW LIFE EXPERIENCE

Technologic wear for work and life that is equipped with innovative engineered features to provide unique user characteristics transforming life experience. They may include strengthened resistance across different environments, reinforced protection, embedded heating elements, AR/VR components, data exchange elements, wireless brain-computer interfaces, and others.

RARE APPAREL. Impossible fashion. Seed-stage startup in fashion, technology, and design. Vegan slow circular fashion. www.hasheight.com #hasheight #rareapparel #askmydress #hornofplenty #pokerface #annamariaserafimaraevskayarepnina #raevskayarepnina #аннамариясерафимараевскаярепнина  #raevskayarepninaannamariaserafima #annamariaserafimaraevskayarepnina #raevskayarepnina #аннамариясерафимараевскаярепнина #раевскаярепнинааннамариясерафима #раевскаярепнина  #oxfordbusinessalumni #startedinoxford #saidbusinessschool #oxfordsbs #oxford #moscow #london #russia #uk #womanfounders #serialentrepreneur #womeninlaw #womeninbusiness #theuniversityofoxford #innovateuk
APPLICATION DOMAIN

Protective overgarment

Industrial wear

Aerospace

Defense

Chemicals

Oil & gas

Nuclear industry

Healthcare

AR/VR games

AR/VR business processes

Education

SMART ADD-ONS

Smart add-ons

Chips

Tags

Marks

Sensors

Detectors

Embedded communication devices

Embedded medical devices

Optical components

Other technical devices

MASS PRODUCTS

Work-a-day clothes made of raw materials free from the ingredients of animal origin which provide the same or better user characteristics.